PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B03331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family EIL
Protein Properties Length: 611aa    MW: 67949.3 Da    PI: 5.8253
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B03331.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3434.69.5e-133384171352
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     e+l +rmwkd+++l+r+ker+++l + ++aa+++++ + +++qa rkkmsraQDgiLkYMlk mevcna+GfvYgiip+kgkpv+gasd++raWW
  Pahal.B03331.1  38 EDLARRMWKDRVRLRRIKERQQKL-ALQQAALEKSRPKPISDQALRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPDKGKPVSGASDNIRAWW 131
                     89*******************986.577777**************************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai ky+++nl++++++s    + +++hsl++lqD+tlgSLLs+lmqhc+ppqr++plekg++pPWWP+G+e+ww +lgl+  q
  Pahal.B03331.1 132 KEKVKFDKNGPAAIEKYESENLVSANAQSG---GIKNQHSLMDLQDATLGSLLSSLMQHCNPPQRKYPLEKGTPPPWWPSGNEEWWIALGLPSGQ 223
                     *************************98888...88***********************************************************9 PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XX....XXXXXXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah.ss....slrkqspkvtlsceq 280
                       ppykkphdlkk+wkv+vLt vikhmsp++++ir+++r+sk+lqdkm+akes ++l vl++ee++++++    s+    sl ++++  t+s+++
  Pahal.B03331.1 224 I-PPYKKPHDLKKVWKVGVLTGVIKHMSPNFDKIRNHVRKSKCLQDKMTAKESLIWLGVLQREERLVHRIDNGvSEisnhSLLEDRNGETISSSN 317
                     9.9******************************************************************9998633556788889999******* PP

                     XXXXXXXXXXX.XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXX.XXX......XXXXXXX.XXXXXXXXXX CS
            EIN3 281 kedvegkkeskikhvqavktta...........................gfpvvrkrkkkpsesakv.sskevsrtcqssqfrgsetelifadkn 347
                     ++dv+g ++   ++++++++++                           ++p    rk++p+++++  ss+++    qs     +++++ ++d+n
  Pahal.B03331.1 318 EYDVDGFEDAPLSTSSKDDEQDlspvaqsaeehvpkrgreraynkrpsqTVPSKAGRKEPPKRKRARhSSTGIEPDIQSVDEAPENPRNLIPDMN 412
                     *****888888799999999889999999999999999999999999885555555555554444330344555556777777778888888888 PP

                     XXXXX CS
            EIN3 348 sisqn 352
                     +++q 
  Pahal.B03331.1 413 QLDQV 417
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.8E-12738286No hitNo description
Gene3DG3DSA:1.10.3180.105.3E-70161293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.83E-60166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MDQLAILATE LVDSSDFEVE GIQNLTENDV SDEEIEAEDL ARRMWKDRVR LRRIKERQQK  60
LALQQAALEK SRPKPISDQA LRKKMSRAQD GILKYMLKLM EVCNARGFVY GIIPDKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAIEKYES ENLVSANAQS GGIKNQHSLM DLQDATLGSL  180
LSSLMQHCNP PQRKYPLEKG TPPPWWPSGN EEWWIALGLP SGQIPPYKKP HDLKKVWKVG  240
VLTGVIKHMS PNFDKIRNHV RKSKCLQDKM TAKESLIWLG VLQREERLVH RIDNGVSEIS  300
NHSLLEDRNG ETISSSNEYD VDGFEDAPLS TSSKDDEQDL SPVAQSAEEH VPKRGRERAY  360
NKRPSQTVPS KAGRKEPPKR KRARHSSTGI EPDIQSVDEA PENPRNLIPD MNQLDQVEIQ  420
GMATQIVSSN HGGTTSEVLH HKGDTQVQVH LPGAEGNNFD GAPAADATPI SIYVGAKHLP  480
YQNSDSARSR SENNFTVDAD PGLNDLPSSY HTLPLKQSLP LSMMDHHVVP MGIRAPSDNI  540
PYGGHILGGN STSVPGDMQQ LIDFPFYGEQ DKFVGSSFEG LPLDYISISS PIPDIDDLLH  600
DDDLMEYLGT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-661662919134ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957192.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_004957193.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-149EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK3ZRM90.0K3ZRM9_SETIT; Uncharacterized protein
STRINGSi029258m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-147ETHYLENE-INSENSITIVE3-like 3